![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
![]() | Protein Protein phosphatase-1 (PP-1) [56311] (6 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [160869] (2 PDB entries) |
![]() | Domain d2o8ga_: 2o8g A: [148674] automated match to d3c5wc_ complexed with mn |
PDB Entry: 2o8g (more details), 2.5 Å
SCOPe Domain Sequences for d2o8ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o8ga_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]} klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpae
Timeline for d2o8ga_: