SCOP 1.75: Domain d2o8ga1: 2o8g A:6-299

Lineage for d2o8ga1 (2o8g A:6-299)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (12 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (5 proteins)

6. Protein Protein phosphatase-1 (PP-1) [56311] (4 species)

7. Species Rattus norvegicus [TaxId:10116] [160869] (2 PDB entries)

8. Domain d2o8ga1: 2o8g A:6-299 [148674]
   automatically matched to d1jk7a_
   complexed with mn

Details for d2o8ga1

PDB Entry: 2o8g, 2.5 Å

PDB Description: rat pp1c gamma complexed with mouse inhibitor-2

PDB Compounds: (A:) Serine/threonine-protein phosphatase PP1-gamma catalytic subunit

SCOP Domain Sequences for d2o8ga1:

Sequence; same for both SEQRES and ATOM records:

>d2o8ga1 d.159.1.3 (A:6-299) Protein phosphatase-1 (PP-1) {Rattus norvegicus [TaxId: 10116]}
klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

Timeline for d2o8ga1:

• d2o8ga1 is new in SCOP 1.75
  
• d2o8ga1 appears in SCOPe 2.01
  
• d2o8ga1 appears in the current release, SCOPe 2.08, called d2o8ga_