SCOPe 2.07: Domain d2o6kb2: 2o6k B:4-73

Lineage for d2o6kb2 (2o6k B:4-73)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.15: YozE-like [140652] (1 family)

5. Family a.60.15.1: YozE-like [140653] (2 proteins)
   Pfam PF06855; DUF1250

6. Protein Uncharacterized protein MW1311 [158542] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [158543] (1 PDB entry)
   Uniprot Q7BEF3 4-73

8. Domain d2o6kb2: 2o6k B:4-73 [148633]
   Other proteins in same PDB: d2o6ka2, d2o6kb3
   automated match to d2o6ka1

Details for d2o6kb2

PDB Entry: 2o6k, 2.1 Å

PDB Description: crystal structure of upf0346 from staphylococcus aureus. northeast structural genomics target zr218.

PDB Compounds: (B:) UPF0346 protein MW1311

SCOPe Domain Sequences for d2o6kb2:

Sequence; same for both SEQRES and ATOM records:

>d2o6kb2 a.60.15.1 (B:4-73) Uncharacterized protein MW1311 {Staphylococcus aureus [TaxId: 1280]}
ysfyqfvmtvrgrhddkgrlaeeifddlafpkhdddfnilsdyiethgdftlpmsvfddl
yeeytewlkf

Timeline for d2o6kb2:

• d2o6kb2 first appeared in SCOP 1.75, called d2o6kb1
  
• d2o6kb2 appears in SCOPe 2.06
  
• d2o6kb2 appears in the current release, SCOPe 2.08