Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.15: YozE-like [140652] (1 family) |
Family a.60.15.1: YozE-like [140653] (2 proteins) Pfam PF06855; DUF1250 |
Protein Uncharacterized protein MW1311 [158542] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [158543] (1 PDB entry) Uniprot Q7BEF3 4-73 |
Domain d2o6kb2: 2o6k B:4-73 [148633] Other proteins in same PDB: d2o6ka2, d2o6kb3 automated match to d2o6ka1 |
PDB Entry: 2o6k (more details), 2.1 Å
SCOPe Domain Sequences for d2o6kb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o6kb2 a.60.15.1 (B:4-73) Uncharacterized protein MW1311 {Staphylococcus aureus [TaxId: 1280]} ysfyqfvmtvrgrhddkgrlaeeifddlafpkhdddfnilsdyiethgdftlpmsvfddl yeeytewlkf
Timeline for d2o6kb2: