Lineage for d2o6kb1 (2o6k B:4-73)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 771604Superfamily a.60.15: YozE-like [140652] (1 family) (S)
  5. 771605Family a.60.15.1: YozE-like [140653] (2 protein domains)
    Pfam PF06855; DUF1250
  6. 771609Protein Uncharacterized protein MW1311 [158542] (1 species)
  7. 771610Species Staphylococcus aureus [TaxId:1280] [158543] (1 PDB entry)
    Uniprot Q7BEF3 4-73
  8. 771612Domain d2o6kb1: 2o6k B:4-73 [148633]
    automatically matched to 2O6K A:4-73

Details for d2o6kb1

PDB Entry: 2o6k (more details), 2.1 Å

PDB Description: crystal structure of upf0346 from staphylococcus aureus. northeast structural genomics target zr218.
PDB Compounds: (B:) UPF0346 protein MW1311

SCOP Domain Sequences for d2o6kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o6kb1 a.60.15.1 (B:4-73) Uncharacterized protein MW1311 {Staphylococcus aureus [TaxId: 1280]}
ysfyqfvmtvrgrhddkgrlaeeifddlafpkhdddfnilsdyiethgdftlpmsvfddl
yeeytewlkf

SCOP Domain Coordinates for d2o6kb1:

Click to download the PDB-style file with coordinates for d2o6kb1.
(The format of our PDB-style files is described here.)

Timeline for d2o6kb1: