![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.7: CUT domain [116891] (5 proteins) Pfam PF02376 |
![]() | Protein automated matches [190367] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187202] (2 PDB entries) |
![]() | Domain d2o4aa2: 2o4a A:370-452 [148582] Other proteins in same PDB: d2o4aa3 automated match to d1ysea1 protein/DNA complex |
PDB Entry: 2o4a (more details), 1.75 Å
SCOPe Domain Sequences for d2o4aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o4aa2 a.35.1.7 (A:370-452) automated matches {Human (Homo sapiens) [TaxId: 9606]} evsseiyqwvrdelkragisqavfarvafnrtqgllseilrkeedpktasqsllvnlram qnflqlpeaerdriyqderersl
Timeline for d2o4aa2: