SCOPe 2.08: Domain d2o4aa2: 2o4a A:370-452

Lineage for d2o4aa2 (2o4a A:370-452)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.7: CUT domain [116891] (5 proteins)
   Pfam PF02376

6. Protein automated matches [190367] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187202] (2 PDB entries)

8. Domain d2o4aa2: 2o4a A:370-452 [148582]
   Other proteins in same PDB: d2o4aa3
   automated match to d1ysea1
   protein/DNA complex

Details for d2o4aa2

PDB Entry: 2o4a, 1.75 Å

PDB Description: Crystal Structure of the N-terminal CUT Domain of SATB1 Bound to Matrix Attachment Region DNA

PDB Compounds: (A:) DNA-binding protein SATB1

SCOPe Domain Sequences for d2o4aa2:

Sequence; same for both SEQRES and ATOM records:

>d2o4aa2 a.35.1.7 (A:370-452) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evsseiyqwvrdelkragisqavfarvafnrtqgllseilrkeedpktasqsllvnlram
qnflqlpeaerdriyqderersl

Timeline for d2o4aa2:

• d2o4aa2 first appeared in SCOP 1.75, called d2o4aa1
  
• d2o4aa2 appears in SCOPe 2.07