Lineage for d2o4aa1 (2o4a A:370-452)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768002Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 768003Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 768258Family a.35.1.7: CUT domain [116891] (4 proteins)
    Pfam PF02376
  6. 768259Protein DNA-binding protein SATB1 [140518] (1 species)
  7. 768260Species Human (Homo sapiens) [TaxId:9606] [140519] (3 PDB entries)
    Uniprot Q01826 368-455
  8. 768261Domain d2o4aa1: 2o4a A:370-452 [148582]
    automatically matched to d1ysea1

Details for d2o4aa1

PDB Entry: 2o4a (more details), 1.75 Å

PDB Description: Crystal Structure of the N-terminal CUT Domain of SATB1 Bound to Matrix Attachment Region DNA
PDB Compounds: (A:) DNA-binding protein SATB1

SCOP Domain Sequences for d2o4aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o4aa1 a.35.1.7 (A:370-452) DNA-binding protein SATB1 {Human (Homo sapiens) [TaxId: 9606]}
evsseiyqwvrdelkragisqavfarvafnrtqgllseilrkeedpktasqsllvnlram
qnflqlpeaerdriyqderersl

SCOP Domain Coordinates for d2o4aa1:

Click to download the PDB-style file with coordinates for d2o4aa1.
(The format of our PDB-style files is described here.)

Timeline for d2o4aa1: