SCOPe 2.01: Domain d2o2ac_: 2o2a C:

Lineage for d2o2ac_ (2o2a C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.33: SecB-like [54610] (1 superfamily)
   beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432

4. Superfamily d.33.1: SecB-like [54611] (2 families)

5. Family d.33.1.2: SP1558-like [160154] (2 proteins)
   Pfam PF06619; DUF1149

6. Protein Hypothetical protein gbs1413 [160157] (1 species)

7. Species Streptococcus agalactiae [TaxId:1311] [160158] (1 PDB entry)
   Uniprot Q8E4I8 1-124

8. Domain d2o2ac_: 2o2a C: [148552]
   automated match to d2o2aa1

Details for d2o2ac_

PDB Entry: 2o2a, 2.1 Å

PDB Description: The crystal structure of a protein of unknown function from Streptococcus agalactiae

PDB Compounds: (C:) Hypothetical protein gbs1413

SCOPe Domain Sequences for d2o2ac_:

Sequence; same for both SEQRES and ATOM records:

>d2o2ac_ d.33.1.2 (C:) Hypothetical protein gbs1413 {Streptococcus agalactiae [TaxId: 1311]}
aamevireqefvnqyhydarnleweeengtpktnfevtfqlanrdeaakvtsivavlqfv
ivrdefvisgvisqmahiqgrlinepsefsqdevenlaaplleivkrltyevteialdrp
gvtlef

Timeline for d2o2ac_:

• d2o2ac_ first appeared in SCOP 1.75, called d2o2ac1
  
• d2o2ac_ appears in SCOPe 2.02
  
• d2o2ac_ appears in the current release, SCOPe 2.08, called d2o2ac2