SCOP 1.75: Domain d2o2ac1: 2o2a C:1-124

Lineage for d2o2ac1 (2o2a C:1-124)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.33: SecB-like [54610] (1 superfamily)
   beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432

4. Superfamily d.33.1: SecB-like [54611] (2 families)

5. Family d.33.1.2: SP1558-like [160154] (2 proteins)
   Pfam PF06619; DUF1149

6. Protein Hypothetical protein gbs1413 [160157] (1 species)

7. Species Streptococcus agalactiae [TaxId:1311] [160158] (1 PDB entry)
   Uniprot Q8E4I8 1-124

8. Domain d2o2ac1: 2o2a C:1-124 [148552]
   automatically matched to 2O2A A:1-124

Details for d2o2ac1

PDB Entry: 2o2a, 2.1 Å

PDB Description: The crystal structure of a protein of unknown function from Streptococcus agalactiae

PDB Compounds: (C:) Hypothetical protein gbs1413

SCOP Domain Sequences for d2o2ac1:

Sequence; same for both SEQRES and ATOM records:

>d2o2ac1 d.33.1.2 (C:1-124) Hypothetical protein gbs1413 {Streptococcus agalactiae [TaxId: 1311]}
mevireqefvnqyhydarnleweeengtpktnfevtfqlanrdeaakvtsivavlqfviv
rdefvisgvisqmahiqgrlinepsefsqdevenlaaplleivkrltyevteialdrpgv
tlef

Timeline for d2o2ac1:

• d2o2ac1 is new in SCOP 1.75
  
• d2o2ac1 is called d2o2ac_ in SCOPe 2.01
  
• d2o2ac1 appears in the current release, SCOPe 2.08, called d2o2ac2