Lineage for d2o1aa1 (2o1a A:17-138)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2376607Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2376608Family b.1.28.1: NEAT domain [158912] (4 proteins)
    Pfam PF05031; iron transport-associated domain
  6. 2376609Protein Iron-regulated surface determinant protein A, IsdA [158915] (1 species)
  7. 2376610Species Staphylococcus aureus [TaxId:1280] [158916] (3 PDB entries)
    Uniprot Q7A152 64-184! Uniprot Q99UX4 63-184
  8. 2376611Domain d2o1aa1: 2o1a A:17-138 [148546]
    complexed with edo, so4

Details for d2o1aa1

PDB Entry: 2o1a (more details), 1.6 Å

PDB Description: Crystal structure of iron-regulated surface determinant protein A from Staphylococcus aureus- targeted domain 47...188
PDB Compounds: (A:) Iron-regulated surface determinant protein A

SCOPe Domain Sequences for d2o1aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o1aa1 b.1.28.1 (A:17-138) Iron-regulated surface determinant protein A, IsdA {Staphylococcus aureus [TaxId: 1280]}
qatsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynan
nqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaipt
la

SCOPe Domain Coordinates for d2o1aa1:

Click to download the PDB-style file with coordinates for d2o1aa1.
(The format of our PDB-style files is described here.)

Timeline for d2o1aa1: