PDB entry 2o1a

View 2o1a on RCSB PDB site
Description: Crystal structure of iron-regulated surface determinant protein A from Staphylococcus aureus- targeted domain 47...188
Class: surface active protein
Keywords: surface protein Staphylococcus aureus, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, SURFACE ACTIVE PROTEIN
Deposited on 2006-11-28, released 2006-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.169
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Iron-regulated surface determinant protein A
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: isdA, frpA, stbA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99UX4
    • modified residue (37)
    • modified residue (41)
  Domains in SCOPe 2.07: d2o1aa1
• Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2o1aA (A:)
  ateatnatnnqstqvsqatsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtv
  lnnasfwkeykfynannqelattvvndnkkadtrtinvavepgykslttkvhivvpqiny
  nhrytthlefekaiptladaak
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2o1aA (A:)
  qatsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynan
  nqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaipt
  la