Lineage for d2nxpa1 (2nxp A:195-343)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617544Fold d.379: Taf5 N-terminal domain-like [160896] (1 superfamily)
    multihelical cluster with a C-terminal beta-alpha(2)-beta motif; one central buried helix; parallel beta-ribbon
  4. 2617545Superfamily d.379.1: Taf5 N-terminal domain-like [160897] (1 family) (S)
    automatically mapped to Pfam PF04494
  5. 2617546Family d.379.1.1: Taf5 N-terminal domain-like [160898] (2 proteins)
    Pfam PF04494
  6. 2617547Protein TAF5 subunit of TFIID [160899] (3 species)
  7. 2617552Species Human (Homo sapiens) [TaxId:9606] [160900] (1 PDB entry)
    Uniprot Q15542 195-343
  8. 2617553Domain d2nxpa1: 2nxp A:195-343 [148504]
    complexed with ca

Details for d2nxpa1

PDB Entry: 2nxp (more details), 2.17 Å

PDB Description: Structure of NTD2 domain of the human TAF5 subunit of TFIID
PDB Compounds: (A:) Transcription initiation factor TFIID subunit 5

SCOPe Domain Sequences for d2nxpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nxpa1 d.379.1.1 (A:195-343) TAF5 subunit of TFIID {Human (Homo sapiens) [TaxId: 9606]}
qpdvsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhmylelvyn
qheneaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvlrisrdsy
qllkrhlqekqnnqiwnivqehlyidifd

SCOPe Domain Coordinates for d2nxpa1:

Click to download the PDB-style file with coordinates for d2nxpa1.
(The format of our PDB-style files is described here.)

Timeline for d2nxpa1: