PDB entry 2nxp

View 2nxp on RCSB PDB site
Description: Structure of NTD2 domain of the human TAF5 subunit of TFIID
Class: transcription
Keywords: Transcription factor, TFIID subunit, TAF5
Deposited on 2006-11-17, released 2007-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.215
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription initiation factor TFIID subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: TAF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15542 (Start-155)
      • modified residue (25)
      • modified residue (59)
      • modified residue (103)
      • modified residue (109)
    Domains in SCOPe 2.07: d2nxpa1
  • Chain 'B':
    Compound: Transcription initiation factor TFIID subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: TAF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15542
      • modified residue (25)
      • modified residue (59)
      • modified residue (103)
      • modified residue (109)
    Domains in SCOPe 2.07: d2nxpb_
  • Chain 'C':
    Compound: Transcription initiation factor TFIID subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: TAF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15542 (Start-155)
      • modified residue (25)
      • modified residue (59)
      • modified residue (103)
      • modified residue (109)
    Domains in SCOPe 2.07: d2nxpc_
  • Chain 'D':
    Compound: Transcription initiation factor TFIID subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: TAF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15542 (Start-155)
      • modified residue (25)
      • modified residue (59)
      • modified residue (103)
      • modified residue (109)
    Domains in SCOPe 2.07: d2nxpd_
  • Chain 'E':
    Compound: Transcription initiation factor TFIID subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: TAF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15542 (Start-155)
      • modified residue (25)
      • modified residue (59)
      • modified residue (103)
      • modified residue (109)
    Domains in SCOPe 2.07: d2nxpe_
  • Chain 'F':
    Compound: Transcription initiation factor TFIID subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: TAF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15542 (Start-155)
      • modified residue (25)
      • modified residue (59)
      • modified residue (103)
      • modified residue (109)
    Domains in SCOPe 2.07: d2nxpf_
  • Chain 'G':
    Compound: Transcription initiation factor TFIID subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: TAF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15542 (Start-155)
      • modified residue (25)
      • modified residue (59)
      • modified residue (103)
      • modified residue (109)
    Domains in SCOPe 2.07: d2nxpg_
  • Chain 'H':
    Compound: Transcription initiation factor TFIID subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: TAF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15542 (Start-155)
      • modified residue (25)
      • modified residue (59)
      • modified residue (103)
      • modified residue (109)
    Domains in SCOPe 2.07: d2nxph_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nxpA (A:)
    gsvavedqpdvsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhm
    ylelvynqheneaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvl
    risrdsyqllkrhlqekqnnqiwnivqehlyidifd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxpA (A:)
    qpdvsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhmylelvyn
    qheneaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvlrisrdsy
    qllkrhlqekqnnqiwnivqehlyidifd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nxpB (B:)
    gsvavedqpdvsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhm
    ylelvynqheneaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvl
    risrdsyqllkrhlqekqnnqiwnivqehlyidifd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxpB (B:)
    vsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhmylelvynqhe
    neaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvlrisrdsyqll
    krhlqekqnnqiwnivqehlyidif
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2nxpC (C:)
    gsvavedqpdvsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhm
    ylelvynqheneaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvl
    risrdsyqllkrhlqekqnnqiwnivqehlyidifd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxpC (C:)
    dvsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhmylelvynqh
    eneaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvlrisrdsyql
    lkrhlqekqnnqiwnivqehlyidifd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nxpD (D:)
    gsvavedqpdvsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhm
    ylelvynqheneaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvl
    risrdsyqllkrhlqekqnnqiwnivqehlyidifd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxpD (D:)
    dvsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhmylelvynqh
    eneaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvlrisrdsyql
    lkrhlqekqnnqiwnivqehlyidifd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2nxpE (E:)
    gsvavedqpdvsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhm
    ylelvynqheneaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvl
    risrdsyqllkrhlqekqnnqiwnivqehlyidifd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxpE (E:)
    pdvsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhmylelvynq
    heneaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvlrisrdsyq
    llkrhlqekqnnqiwnivqehlyidifd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2nxpF (F:)
    gsvavedqpdvsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhm
    ylelvynqheneaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvl
    risrdsyqllkrhlqekqnnqiwnivqehlyidifd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxpF (F:)
    vsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhmylelvynqhe
    neaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvlrisrdsyqll
    krhlqekqnnqiwnivqehlyidifd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2nxpG (G:)
    gsvavedqpdvsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhm
    ylelvynqheneaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvl
    risrdsyqllkrhlqekqnnqiwnivqehlyidifd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxpG (G:)
    vsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhmylelvynqhe
    neaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvlrisrdsyqll
    krhlqekqnnqiwnivqehlyidifd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2nxpH (H:)
    gsvavedqpdvsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhm
    ylelvynqheneaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvl
    risrdsyqllkrhlqekqnnqiwnivqehlyidifd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxpH (H:)
    savlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhmylelvynqhen
    eaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvlrisrdsyqllk
    rhlqekqnnqiwnivqehlyidifd