SCOPe 2.08: Domain d2nwag2: 2nwa G:1-80

Lineage for d2nwag2 (2nwa G:1-80)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.13: YtmB-like [159372] (1 protein)
   PfamB PB020780
   automatically mapped to Pfam PF10763

6. Protein Hypothetical protein YtmB [159373] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [159374] (1 PDB entry)
   Uniprot O34365 1-80

8. Domain d2nwag2: 2nwa G:1-80 [148486]
   Other proteins in same PDB: d2nwaa2, d2nwab3, d2nwac3, d2nwad3, d2nwae3, d2nwaf3, d2nwag3, d2nwah3
   automated match to d2nwaa1
   complexed with so4

Details for d2nwag2

PDB Entry: 2nwa, 2.7 Å

PDB Description: x-ray crystal structure of protein ytmb from bacillus subtilis. northeast structural genomics consortium target sr466

PDB Compounds: (G:) Hypothetical protein ytmB

SCOPe Domain Sequences for d2nwag2:

Sequence, based on SEQRES records:

>d2nwag2 b.122.1.13 (G:1-80) Hypothetical protein YtmB {Bacillus subtilis [TaxId: 1423]}
mgmpvefntlivtkgkevrideniftlekdgyrvypmeipmdvrktkfgeksgtaevqkl
qweegrtiitykltslhsvn

Sequence, based on observed residues (ATOM records):

>d2nwag2 b.122.1.13 (G:1-80) Hypothetical protein YtmB {Bacillus subtilis [TaxId: 1423]}
mgmpvefntlivtkgkevrideniftlekdgyrvypmeipmdvrktkfeksgtaevqklq
weegrtiitykltslhsvn

Timeline for d2nwag2:

• d2nwag2 first appeared in SCOP 1.75, called d2nwag1
  
• d2nwag2 appears in SCOPe 2.07