Lineage for d2nwaa1 (2nwa A:1-80)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2824111Family b.122.1.13: YtmB-like [159372] (1 protein)
    PfamB PB020780
    automatically mapped to Pfam PF10763
  6. 2824112Protein Hypothetical protein YtmB [159373] (1 species)
  7. 2824113Species Bacillus subtilis [TaxId:1423] [159374] (1 PDB entry)
    Uniprot O34365 1-80
  8. 2824114Domain d2nwaa1: 2nwa A:1-80 [148480]
    Other proteins in same PDB: d2nwaa2, d2nwab3, d2nwac3, d2nwad3, d2nwae3, d2nwaf3, d2nwag3, d2nwah3
    complexed with so4

Details for d2nwaa1

PDB Entry: 2nwa (more details), 2.7 Å

PDB Description: x-ray crystal structure of protein ytmb from bacillus subtilis. northeast structural genomics consortium target sr466
PDB Compounds: (A:) Hypothetical protein ytmB

SCOPe Domain Sequences for d2nwaa1:

Sequence, based on SEQRES records: (download)

>d2nwaa1 b.122.1.13 (A:1-80) Hypothetical protein YtmB {Bacillus subtilis [TaxId: 1423]}
mgmpvefntlivtkgkevrideniftlekdgyrvypmeipmdvrktkfgeksgtaevqkl
qweegrtiitykltslhsvn

Sequence, based on observed residues (ATOM records): (download)

>d2nwaa1 b.122.1.13 (A:1-80) Hypothetical protein YtmB {Bacillus subtilis [TaxId: 1423]}
mgmpvefntlivtkgkevrideniftlekdgyrvypmeipmdvrktkfeksgtaevqklq
weegrtiitykltslhsvn

SCOPe Domain Coordinates for d2nwaa1:

Click to download the PDB-style file with coordinates for d2nwaa1.
(The format of our PDB-style files is described here.)

Timeline for d2nwaa1: