SCOPe 2.07: Domain d2nvpa1: 2nvp A:2-427

Lineage for d2nvpa1 (2nvp A:2-427)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.8: CPF0428-like [158737] (3 proteins)
   Pfam PF06824; DUF1237

6. Protein Hypothetical protein CPF0428 [158740] (2 species)

7. Species Clostridium perfringens [TaxId:1502] [158741] (3 PDB entries)
   Uniprot Q0TU05 2-427

8. Domain d2nvpa1: 2nvp A:2-427 [148478]
   Other proteins in same PDB: d2nvpa2

Details for d2nvpa1

PDB Entry: 2nvp, 2.2 Å

PDB Description: x-ray crystal structure of protein cpf_0428 from clostridium perfringens. northeast structural genomics consortium target cpr63.

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2nvpa1:

Sequence; same for both SEQRES and ATOM records:

>d2nvpa1 a.102.1.8 (A:2-427) Hypothetical protein CPF0428 {Clostridium perfringens [TaxId: 1502]}
slstnelkeivrkigkdlsgkiedkklqelfyncfintmdttvevsegdafvitgdipam
wlrdstsqvehylpfvkeypelkaiftglinrqvkcifidpyanafnkepngqkwdndit
kdspwvwerkyeidslcypvrlihkywkesgdetffnddikkafnmiidlwrveqyhrek
sdysfqrlncsvtdtlsheglgtpvtytgmtwsgfrpsddaceygylipanmfavvalry
iseiaekvykdeelkekadslreeidnaiekhgkvykegfgevyayetdgmgnynfmdda
nvpsllsipyleykgiedevyqntrkfilsknnrfffegkaakgigsphtpdqyiwhial
smqglttnnqeeidqlikllketdagtgymhegfhvddptkftrdwfawsnslfshfiye
kvinkk

Timeline for d2nvpa1:

• d2nvpa1 first appeared in SCOP 1.75
  
• d2nvpa1 appears in SCOPe 2.06
  
• d2nvpa1 appears in the current release, SCOPe 2.08