Lineage for d2nvpa1 (2nvp A:2-427)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004252Family a.102.1.8: CPF0428-like [158737] (3 protein domains)
    Pfam PF06824; DUF1237
  6. 2004257Protein Hypothetical protein CPF0428 [158740] (2 species)
  7. 2004258Species Clostridium perfringens [TaxId:1502] [158741] (3 PDB entries)
    Uniprot Q0TU05 2-427
  8. 2004261Domain d2nvpa1: 2nvp A:2-427 [148478]
    Other proteins in same PDB: d2nvpa2

Details for d2nvpa1

PDB Entry: 2nvp (more details), 2.2 Å

PDB Description: x-ray crystal structure of protein cpf_0428 from clostridium perfringens. northeast structural genomics consortium target cpr63.
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2nvpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvpa1 a.102.1.8 (A:2-427) Hypothetical protein CPF0428 {Clostridium perfringens [TaxId: 1502]}
slstnelkeivrkigkdlsgkiedkklqelfyncfintmdttvevsegdafvitgdipam
wlrdstsqvehylpfvkeypelkaiftglinrqvkcifidpyanafnkepngqkwdndit
kdspwvwerkyeidslcypvrlihkywkesgdetffnddikkafnmiidlwrveqyhrek
sdysfqrlncsvtdtlsheglgtpvtytgmtwsgfrpsddaceygylipanmfavvalry
iseiaekvykdeelkekadslreeidnaiekhgkvykegfgevyayetdgmgnynfmdda
nvpsllsipyleykgiedevyqntrkfilsknnrfffegkaakgigsphtpdqyiwhial
smqglttnnqeeidqlikllketdagtgymhegfhvddptkftrdwfawsnslfshfiye
kvinkk

SCOPe Domain Coordinates for d2nvpa1:

Click to download the PDB-style file with coordinates for d2nvpa1.
(The format of our PDB-style files is described here.)

Timeline for d2nvpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nvpa2