SCOPe 2.03: Domain d2nueb2: 2nue B:151-220

Lineage for d2nueb2 (2nue B:151-220)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
   Pfam PF00035

6. Protein RNase III, C-terminal domain [54776] (3 species)

7. Species Aquifex aeolicus [TaxId:63363] [102927] (9 PDB entries)

8. Domain d2nueb2: 2nue B:151-220 [148447]
   Other proteins in same PDB: d2nuea1, d2nueb1
   automatically matched to d1rc7a2
   protein/RNA complex

Details for d2nueb2

PDB Entry: 2nue, 2.9 Å

PDB Description: crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 2.9-angstrom resolution

PDB Compounds: (B:) Ribonuclease III

SCOPe Domain Sequences for d2nueb2:

Sequence; same for both SEQRES and ATOM records:

>d2nueb2 d.50.1.1 (B:151-220) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa
eelikllees

Timeline for d2nueb2:

• d2nueb2 first appeared in SCOP 1.75
  
• d2nueb2 appears in SCOPe 2.02
  
• d2nueb2 appears in SCOPe 2.04
  
• d2nueb2 appears in the current release, SCOPe 2.08