Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) |
Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins) Pfam PF00035 |
Protein RNase III, C-terminal domain [54776] (3 species) |
Species Aquifex aeolicus [TaxId:63363] [102927] (9 PDB entries) |
Domain d1rc7a2: 1rc7 A:151-220 [97290] Other proteins in same PDB: d1rc7a1 protein/RNA complex; complexed with trs; mutant |
PDB Entry: 1rc7 (more details), 2.15 Å
SCOPe Domain Sequences for d1rc7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rc7a2 d.50.1.1 (A:151-220) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa eelikllees
Timeline for d1rc7a2: