SCOPe 2.04: Domain d1rc7a2: 1rc7 A:151-220

Lineage for d1rc7a2 (1rc7 A:151-220)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
   Pfam PF00035

6. Protein RNase III, C-terminal domain [54776] (3 species)

7. Species Aquifex aeolicus [TaxId:63363] [102927] (9 PDB entries)

8. Domain d1rc7a2: 1rc7 A:151-220 [97290]
   Other proteins in same PDB: d1rc7a1
   protein/RNA complex; complexed with trs; mutant

Details for d1rc7a2

PDB Entry: 1rc7, 2.15 Å

PDB Description: crystal structure of rnase iii mutant e110k from aquifex aeolicus complexed with ds-rna at 2.15 angstrom resolution

PDB Compounds: (A:) Ribonuclease III

SCOPe Domain Sequences for d1rc7a2:

Sequence; same for both SEQRES and ATOM records:

>d1rc7a2 d.50.1.1 (A:151-220) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa
eelikllees

Timeline for d1rc7a2:

• d1rc7a2 first appeared in SCOP 1.67
  
• d1rc7a2 appears in SCOPe 2.03
  
• d1rc7a2 appears in SCOPe 2.05
  
• d1rc7a2 appears in the current release, SCOPe 2.08