![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.50: dsRBD-like [54767] (3 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) ![]() |
![]() | Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (4 proteins) |
![]() | Protein RNase III, C-terminal domain [54776] (2 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [102927] (1 PDB entry) |
![]() | Domain d1rc7a2: 1rc7 A:151-220 [97290] Other proteins in same PDB: d1rc7a1 complexed with trs; mutant |
PDB Entry: 1rc7 (more details), 2.15 Å
SCOP Domain Sequences for d1rc7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rc7a2 d.50.1.1 (A:151-220) RNase III, C-terminal domain {Aquifex aeolicus} dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa eelikllees
Timeline for d1rc7a2: