Lineage for d1rc7a2 (1rc7 A:151-220)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411345Fold d.50: dsRBD-like [54767] (3 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 411346Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 411347Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (4 proteins)
  6. 411356Protein RNase III, C-terminal domain [54776] (2 species)
  7. 411357Species Aquifex aeolicus [TaxId:63363] [102927] (1 PDB entry)
  8. 411358Domain d1rc7a2: 1rc7 A:151-220 [97290]
    Other proteins in same PDB: d1rc7a1
    complexed with trs; mutant

Details for d1rc7a2

PDB Entry: 1rc7 (more details), 2.15 Å

PDB Description: crystal structure of rnase iii mutant e110k from aquifex aeolicus complexed with ds-rna at 2.15 angstrom resolution

SCOP Domain Sequences for d1rc7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rc7a2 d.50.1.1 (A:151-220) RNase III, C-terminal domain {Aquifex aeolicus}
dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa
eelikllees

SCOP Domain Coordinates for d1rc7a2:

Click to download the PDB-style file with coordinates for d1rc7a2.
(The format of our PDB-style files is described here.)

Timeline for d1rc7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rc7a1