Lineage for d2nueb2 (2nue B:151-220)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1202665Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1202666Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 1202667Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 1202693Protein RNase III, C-terminal domain [54776] (3 species)
  7. 1202694Species Aquifex aeolicus [TaxId:63363] [102927] (9 PDB entries)
  8. 1202709Domain d2nueb2: 2nue B:151-220 [148447]
    Other proteins in same PDB: d2nuea1, d2nueb1
    automatically matched to d1rc7a2
    protein/RNA complex

Details for d2nueb2

PDB Entry: 2nue (more details), 2.9 Å

PDB Description: crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 2.9-angstrom resolution
PDB Compounds: (B:) Ribonuclease III

SCOPe Domain Sequences for d2nueb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nueb2 d.50.1.1 (B:151-220) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa
eelikllees

SCOPe Domain Coordinates for d2nueb2:

Click to download the PDB-style file with coordinates for d2nueb2.
(The format of our PDB-style files is described here.)

Timeline for d2nueb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nueb1