SCOPe 2.08: Domain d2nuea1: 2nue A:2-150

Lineage for d2nuea1 (2nue A:2-150)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.149: RNase III domain-like [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III domain-like [69065] (3 families)

5. Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
   Pfam PF00636

6. Protein RNase III endonuclease catalytic domain [69067] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)

8. Domain d2nuea1: 2nue A:2-150 [148444]
   Other proteins in same PDB: d2nuea2, d2nueb2
   automated match to d1rc7a1
   protein/RNA complex

Details for d2nuea1

PDB Entry: 2nue, 2.9 Å

PDB Description: crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 2.9-angstrom resolution

PDB Compounds: (A:) Ribonuclease III

SCOPe Domain Sequences for d2nuea1:

Sequence; same for both SEQRES and ATOM records:

>d2nuea1 a.149.1.1 (A:2-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
kmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspn
kregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsg
rdanftrelfyklfkedilsaikegrvkk

Timeline for d2nuea1:

• d2nuea1 first appeared in SCOP 1.75
  
• d2nuea1 appears in SCOPe 2.07