Lineage for d2nrqa1 (2nrq A:4-144)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031907Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 1031908Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 1032000Family d.77.1.2: SSO1042-like [160489] (5 proteins)
    Pfam PF01877; DUF54
  6. 1032013Protein Hypothetical protein SSO0741 [160494] (1 species)
  7. 1032014Species Sulfolobus solfataricus [TaxId:2287] [160495] (1 PDB entry)
    Uniprot Q9UXC9 4-144
  8. 1032015Domain d2nrqa1: 2nrq A:4-144 [148380]

Details for d2nrqa1

PDB Entry: 2nrq (more details), 2.6 Å

PDB Description: crystal structure of protein sso0741 from sulfolobus solfataricus, pfam duf54
PDB Compounds: (A:) Hypothetical protein ORF-c20_032

SCOPe Domain Sequences for d2nrqa1:

Sequence, based on SEQRES records: (download)

>d2nrqa1 d.77.1.2 (A:4-144) Hypothetical protein SSO0741 {Sulfolobus solfataricus [TaxId: 2287]}
nqaiisvfihetedynkivntiesffsplisnskknvttaqghygnkiiileyrfdrksg
eqffkiilekietselmlilttidshidgsklylrfdkqyliaehrlvlkegddvikcii
sfntslenikeeikklvnsri

Sequence, based on observed residues (ATOM records): (download)

>d2nrqa1 d.77.1.2 (A:4-144) Hypothetical protein SSO0741 {Sulfolobus solfataricus [TaxId: 2287]}
nqaiisvfihetedynkivntiesffsplisnskknvttaqghygnkiiileyrfdrksg
eqffkiilekietselmlilttshidgsklylrfdkqyliaehrlvlkegddvikciisf
ntsnikeeikklvnsri

SCOPe Domain Coordinates for d2nrqa1:

Click to download the PDB-style file with coordinates for d2nrqa1.
(The format of our PDB-style files is described here.)

Timeline for d2nrqa1: