PDB entry 2nrq

View 2nrq on RCSB PDB site
Description: Crystal structure of protein SSO0741 from Sulfolobus solfataricus, Pfam DUF54
Class: structural genomics, unknown function
Keywords: Crystal structure, conserved hypothetical protein, Sulfolobus solfataricus, 10077c, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2006-11-02, released 2006-11-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.245
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ORF-c20_032
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: ORF-c20_032
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UXC9
      • modified residue (81)
    Domains in SCOPe 2.01: d2nrqa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nrqA (A:)
    mslkinqaiisvfihetedynkivntiesffsplisnskknvttaqghygnkiiileyrf
    drksgeqffkiilekietselmlilttidshidgsklylrfdkqyliaehrlvlkegddv
    ikciisfntslenikeeikklvnsrimhskleghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nrqA (A:)
    nqaiisvfihetedynkivntiesffsplisnskknvttaqghygnkiiileyrfdrksg
    eqffkiilekietselmlilttshidgsklylrfdkqyliaehrlvlkegddvikciisf
    ntsnikeeikklvnsri