SCOPe 2.06: Domain d2nrbc1: 2nrb C:261-480

Lineage for d2nrbc1 (2nrb C:261-480)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.3: CoA transferase beta subunit-like [74657] (4 proteins)
   catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest

6. Protein Succinate:CoA transferase, C-terminal domain [82466] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [82467] (8 PDB entries)

8. Domain d2nrbc1: 2nrb C:261-480 [148366]
   Other proteins in same PDB: d2nrba2, d2nrbb2, d2nrbc2, d2nrbd2
   automated match to d1ooza1
   complexed with cl; mutant

Details for d2nrbc1

PDB Entry: 2nrb, 2 Å

PDB Description: c28s mutant of succinyl-coa:3-ketoacid coa transferase from pig heart

PDB Compounds: (C:) Succinyl-CoA:3-ketoacid-coenzyme A transferase 1

SCOPe Domain Sequences for d2nrbc1:

Sequence; same for both SEQRES and ATOM records:

>d2nrbc1 c.124.1.3 (C:261-480) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
nvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnev
dadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgkl
vkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvd
rkkgltlielwegltvddikkstgcdfavspklipmqqvt

Timeline for d2nrbc1:

• d2nrbc1 first appeared in SCOP 1.75
  
• d2nrbc1 appears in SCOPe 2.05
  
• d2nrbc1 appears in SCOPe 2.07
  
• d2nrbc1 appears in the current release, SCOPe 2.08