Lineage for d2nrbc1 (2nrb C:261-480)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922432Family c.124.1.3: CoA transferase beta subunit-like [74657] (4 proteins)
    catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest
  6. 2922451Protein Succinate:CoA transferase, C-terminal domain [82466] (2 species)
  7. 2922457Species Pig (Sus scrofa) [TaxId:9823] [82467] (8 PDB entries)
  8. 2922472Domain d2nrbc1: 2nrb C:261-480 [148366]
    Other proteins in same PDB: d2nrba2, d2nrbb2, d2nrbc2, d2nrbd2
    automated match to d1ooza1
    complexed with cl; mutant

Details for d2nrbc1

PDB Entry: 2nrb (more details), 2 Å

PDB Description: c28s mutant of succinyl-coa:3-ketoacid coa transferase from pig heart
PDB Compounds: (C:) Succinyl-CoA:3-ketoacid-coenzyme A transferase 1

SCOPe Domain Sequences for d2nrbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nrbc1 c.124.1.3 (C:261-480) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
nvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnev
dadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgkl
vkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvd
rkkgltlielwegltvddikkstgcdfavspklipmqqvt

SCOPe Domain Coordinates for d2nrbc1:

Click to download the PDB-style file with coordinates for d2nrbc1.
(The format of our PDB-style files is described here.)

Timeline for d2nrbc1: