SCOPe 2.07: Domain d2nrac2: 2nra C:152-268

Lineage for d2nrac2 (2nra C:152-268)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.10: Replication initiation protein [46816] (3 proteins)
   duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetry

6. Protein Replication initiation protein PI [158284] (1 species)

7. Species Escherichia coli [TaxId:562] [158285] (1 PDB entry)
   Uniprot P03067 152-268! Uniprot P03067 9-151

8. Domain d2nrac2: 2nra C:152-268 [148361]
   protein/DNA complex

Details for d2nrac2

PDB Entry: 2nra, 3.1 Å

PDB Description: crystal structure of pi initiator protein in complex with iteron dna

PDB Compounds: (C:) PI protein

SCOPe Domain Sequences for d2nrac2:

Sequence; same for both SEQRES and ATOM records:

>d2nrac2 a.4.5.10 (C:152-268) Replication initiation protein PI {Escherichia coli [TaxId: 562]}
knkfttqlltaslrlssqyssslyqlirkhysnfkkknyfiisvdelkeeliaytfdkdg
nieykypdfpifkrdvlnkaiaeikkkteisfvgftvhekegrkisklkfefvvded

Timeline for d2nrac2:

• d2nrac2 first appeared in SCOP 1.75
  
• d2nrac2 appears in SCOPe 2.06
  
• d2nrac2 appears in the current release, SCOPe 2.08