Lineage for d2nrac2 (2nra C:152-268)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693223Family a.4.5.10: Replication initiation protein [46816] (3 proteins)
    duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetry
  6. 2693232Protein Replication initiation protein PI [158284] (1 species)
  7. 2693233Species Escherichia coli [TaxId:562] [158285] (1 PDB entry)
    Uniprot P03067 152-268! Uniprot P03067 9-151
  8. 2693235Domain d2nrac2: 2nra C:152-268 [148361]
    protein/DNA complex

Details for d2nrac2

PDB Entry: 2nra (more details), 3.1 Å

PDB Description: crystal structure of pi initiator protein in complex with iteron dna
PDB Compounds: (C:) PI protein

SCOPe Domain Sequences for d2nrac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nrac2 a.4.5.10 (C:152-268) Replication initiation protein PI {Escherichia coli [TaxId: 562]}
knkfttqlltaslrlssqyssslyqlirkhysnfkkknyfiisvdelkeeliaytfdkdg
nieykypdfpifkrdvlnkaiaeikkkteisfvgftvhekegrkisklkfefvvded

SCOPe Domain Coordinates for d2nrac2:

Click to download the PDB-style file with coordinates for d2nrac2.
(The format of our PDB-style files is described here.)

Timeline for d2nrac2: