SCOPe 2.07: Domain d2nr4a1: 2nr4 A:19-210

Lineage for d2nr4a1 (2nr4 A:19-210)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.4: MTH863-like [159164] (3 proteins)
   Pfam PF04289; DUF447; a new dimerisation mode involving (included) all-alpha subdomain of the spectrin-like fold (46965)

6. Protein Hypothetical protein MM1853 [159167] (1 species)

7. Species Methanosarcina mazei [TaxId:2209] [159168] (1 PDB entry)
   Uniprot Q8PVV4 19-210

8. Domain d2nr4a1: 2nr4 A:19-210 [148347]
   complexed with fmn

Details for d2nr4a1

PDB Entry: 2nr4, 1.85 Å

PDB Description: crystal structure of fmn-bound protein mm1853 from methanosarcina mazei, pfam duf447

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2nr4a1:

Sequence, based on SEQRES records:

>d2nr4a1 b.45.1.4 (A:19-210) Hypothetical protein MM1853 {Methanosarcina mazei [TaxId: 2209]}
dlssfgiregiseiiastgfehpnaapigivmkgerpfvrlfkgshtwenvlkekclasn
vvydpilfvrstfsdlvpsefeyvdagefkfpvlkeaiawvvfecinlrntdqslvadlv
plnagfnernikelpvpnrgfnavleatvhatryqltgeekylelirhyeslaskcggda
ekkamkliyeal

Sequence, based on observed residues (ATOM records):

>d2nr4a1 b.45.1.4 (A:19-210) Hypothetical protein MM1853 {Methanosarcina mazei [TaxId: 2209]}
dlssfgiregiseiiastgfehpnaapigivmkgerpfvrlfkgshtwenvlkekclasn
vvydpilfvrstfsdlvpsefeyvdgefkfpvlkeaiawvvfecinlrntdqslvadlvp
lnagfnernikelpvpnrgfnavleatvhatryqltgeekylelirhyeslaskcggdae
kkamkliyeal

Timeline for d2nr4a1:

• d2nr4a1 first appeared in SCOP 1.75
  
• d2nr4a1 appears in SCOPe 2.06
  
• d2nr4a1 appears in the current release, SCOPe 2.08