Lineage for d2nr4a1 (2nr4 A:19-210)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801826Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 801827Superfamily b.45.1: FMN-binding split barrel [50475] (4 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 801972Family b.45.1.4: MTH863-like [159164] (3 proteins)
    Pfam PF04289; DUF447; a new dimerisation mode involving (included) all-alpha subdomain of the spectrin-like fold ((46965))
  6. 801979Protein Hypothetical protein MM1853 [159167] (1 species)
  7. 801980Species Methanosarcina mazei [TaxId:2209] [159168] (1 PDB entry)
    Uniprot Q8PVV4 19-210
  8. 801981Domain d2nr4a1: 2nr4 A:19-210 [148347]
    complexed with fmn

Details for d2nr4a1

PDB Entry: 2nr4 (more details), 1.85 Å

PDB Description: crystal structure of fmn-bound protein mm1853 from methanosarcina mazei, pfam duf447
PDB Compounds: (A:) conserved hypothetical protein

SCOP Domain Sequences for d2nr4a1:

Sequence, based on SEQRES records: (download)

>d2nr4a1 b.45.1.4 (A:19-210) Hypothetical protein MM1853 {Methanosarcina mazei [TaxId: 2209]}
dlssfgiregiseiiastgfehpnaapigivmkgerpfvrlfkgshtwenvlkekclasn
vvydpilfvrstfsdlvpsefeyvdagefkfpvlkeaiawvvfecinlrntdqslvadlv
plnagfnernikelpvpnrgfnavleatvhatryqltgeekylelirhyeslaskcggda
ekkamkliyeal

Sequence, based on observed residues (ATOM records): (download)

>d2nr4a1 b.45.1.4 (A:19-210) Hypothetical protein MM1853 {Methanosarcina mazei [TaxId: 2209]}
dlssfgiregiseiiastgfehpnaapigivmkgerpfvrlfkgshtwenvlkekclasn
vvydpilfvrstfsdlvpsefeyvdgefkfpvlkeaiawvvfecinlrntdqslvadlvp
lnagfnernikelpvpnrgfnavleatvhatryqltgeekylelirhyeslaskcggdae
kkamkliyeal

SCOP Domain Coordinates for d2nr4a1:

Click to download the PDB-style file with coordinates for d2nr4a1.
(The format of our PDB-style files is described here.)

Timeline for d2nr4a1: