Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.26: ICP-like [141066] (2 families) topological variant with similarity to the Cupredoxin-like fold (49502) in the N-terminal region |
Family b.1.26.1: ICP-like [141067] (2 proteins) PfamB PB014070 |
Protein Chagasin [141068] (1 species) |
Species Trypanosoma cruzi [TaxId:5693] [141069] (8 PDB entries) Uniprot Q966X9 3-110 |
Domain d2nqda_: 2nqd A: [148345] automated match to d2fo8a1 complexed with cl, na |
PDB Entry: 2nqd (more details), 1.75 Å
SCOPe Domain Sequences for d2nqda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqda_ b.1.26.1 (A:) Chagasin {Trypanosoma cruzi [TaxId: 5693]} shkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppd skllgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan
Timeline for d2nqda_: