SCOPe 2.08: Domain d2nqda_: 2nqd A:

Lineage for d2nqda_ (2nqd A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.26: ICP-like [141066] (2 families)
   topological variant with similarity to the Cupredoxin-like fold (49502) in the N-terminal region

5. Family b.1.26.1: ICP-like [141067] (2 proteins)
   PfamB PB014070
   automatically mapped to Pfam PF09394

6. Protein Chagasin [141068] (1 species)

7. Species Trypanosoma cruzi [TaxId:5693] [141069] (8 PDB entries)
   Uniprot Q966X9 3-110

8. Domain d2nqda_: 2nqd A: [148345]
   Other proteins in same PDB: d2nqdb_
   automated match to d2fo8a1
   complexed with cl, na

Details for d2nqda_

PDB Entry: 2nqd, 1.75 Å

PDB Description: crystal structure of cysteine protease inhibitor, chagasin, in complex with human cathepsin l

PDB Compounds: (A:) Chagasin

SCOPe Domain Sequences for d2nqda_:

Sequence; same for both SEQRES and ATOM records:

>d2nqda_ b.1.26.1 (A:) Chagasin {Trypanosoma cruzi [TaxId: 5693]}
shkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppd
skllgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan

Timeline for d2nqda_:

• d2nqda_ first appeared in SCOP 1.75, called d2nqda1
  
• d2nqda_ appears in SCOPe 2.07