Lineage for d2nnhb1 (2nnh B:28-490)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1094812Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1094813Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1094814Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 1095153Protein Mammalian cytochrome p450 2c8 [101377] (1 species)
  7. 1095154Species Human (Homo sapiens) [TaxId:9606] [101378] (5 PDB entries)
  8. 1095158Domain d2nnhb1: 2nnh B:28-490 [148318]
    automatically matched to d1pq2a_
    complexed with hem, plm, rea, so4

Details for d2nnhb1

PDB Entry: 2nnh (more details), 2.6 Å

PDB Description: cyp2c8dh complexed with 2 molecules of 9-cis retinoic acid
PDB Compounds: (B:) Cytochrome P450 2C8

SCOPe Domain Sequences for d2nnhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nnhb1 a.104.1.1 (B:28-490) Mammalian cytochrome p450 2c8 {Human (Homo sapiens) [TaxId: 9606]}
klppgptplpiignmlqidvkdicksftnfskvygpvftvyfgmnpivvfhgyeavkeal
idngeefsgrgnspisqritkglgiissngkrwkeirrfslttlrnfgmgkrsiedrvqe
eahclveelrktkaspcdptfilgcapcnvicsvvfqkrfdykdqnfltlmkrfnenfri
lnspwiqvcnnfpllidcfpgthnkvlknvaltrsyirekvkehqasldvnnprdfidcf
likmeqekdnqksefnienlvgtvadlfvagtettsttlryglllllkhpevtakvqeei
dhvigrhrspcmqdrshmpytdavvheiqrysdlvptgvphavttdtkfrnylipkgtti
malltsvlhddkefpnpnifdpghfldkngnfkksdyfmpfsagkricageglarmelfl
flttilqnfnlksvddlknlnttavtkgivslppsyqicfipv

SCOPe Domain Coordinates for d2nnhb1:

Click to download the PDB-style file with coordinates for d2nnhb1.
(The format of our PDB-style files is described here.)

Timeline for d2nnhb1: