Lineage for d2nnhb_ (2nnh B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005379Protein Mammalian cytochrome p450 2c8 [101377] (1 species)
  7. 2005380Species Human (Homo sapiens) [TaxId:9606] [101378] (5 PDB entries)
  8. 2005384Domain d2nnhb_: 2nnh B: [148318]
    automated match to d1pq2a_
    complexed with hem, plm, rea, so4

Details for d2nnhb_

PDB Entry: 2nnh (more details), 2.6 Å

PDB Description: cyp2c8dh complexed with 2 molecules of 9-cis retinoic acid
PDB Compounds: (B:) Cytochrome P450 2C8

SCOPe Domain Sequences for d2nnhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nnhb_ a.104.1.1 (B:) Mammalian cytochrome p450 2c8 {Human (Homo sapiens) [TaxId: 9606]}
klppgptplpiignmlqidvkdicksftnfskvygpvftvyfgmnpivvfhgyeavkeal
idngeefsgrgnspisqritkglgiissngkrwkeirrfslttlrnfgmgkrsiedrvqe
eahclveelrktkaspcdptfilgcapcnvicsvvfqkrfdykdqnfltlmkrfnenfri
lnspwiqvcnnfpllidcfpgthnkvlknvaltrsyirekvkehqasldvnnprdfidcf
likmeqekdnqksefnienlvgtvadlfvagtettsttlryglllllkhpevtakvqeei
dhvigrhrspcmqdrshmpytdavvheiqrysdlvptgvphavttdtkfrnylipkgtti
malltsvlhddkefpnpnifdpghfldkngnfkksdyfmpfsagkricageglarmelfl
flttilqnfnlksvddlknlnttavtkgivslppsyqicfipv

SCOPe Domain Coordinates for d2nnhb_:

Click to download the PDB-style file with coordinates for d2nnhb_.
(The format of our PDB-style files is described here.)

Timeline for d2nnhb_: