Class b: All beta proteins [48724] (180 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.6: YgdI/YgdR-like [159052] (7 proteins) Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals |
Protein Uncharacterized protein PSPPH2109 [159061] (1 species) |
Species Pseudomonas syringae [TaxId:317] [159062] (1 PDB entry) Uniprot Q48JU9 23-74 |
Domain d2k57a1: 2k57 A:2-53 [148272] Other proteins in same PDB: d2k57a2, d2k57a3 |
PDB Entry: 2k57 (more details)
SCOPe Domain Sequences for d2k57a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k57a1 b.38.1.6 (A:2-53) Uncharacterized protein PSPPH2109 {Pseudomonas syringae [TaxId: 317]} asptvitlndgreiqavdtpkydeesgfyefkqldgkqtrinkdqvrtvkdl
Timeline for d2k57a1: