Lineage for d2k57a1 (2k57 A:2-53)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2397007Family b.38.1.6: YgdI/YgdR-like [159052] (7 proteins)
    Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals
  6. 2397025Protein Uncharacterized protein PSPPH2109 [159061] (1 species)
  7. 2397026Species Pseudomonas syringae [TaxId:317] [159062] (1 PDB entry)
    Uniprot Q48JU9 23-74
  8. 2397027Domain d2k57a1: 2k57 A:2-53 [148272]
    Other proteins in same PDB: d2k57a2, d2k57a3

Details for d2k57a1

PDB Entry: 2k57 (more details)

PDB Description: solution nmr structure of putative lipoprotein from pseudomonas syringae gene locus pspto2350. northeast structural genomics target psr76a.
PDB Compounds: (A:) Putative lipoprotein

SCOPe Domain Sequences for d2k57a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k57a1 b.38.1.6 (A:2-53) Uncharacterized protein PSPPH2109 {Pseudomonas syringae [TaxId: 317]}
asptvitlndgreiqavdtpkydeesgfyefkqldgkqtrinkdqvrtvkdl

SCOPe Domain Coordinates for d2k57a1:

Click to download the PDB-style file with coordinates for d2k57a1.
(The format of our PDB-style files is described here.)

Timeline for d2k57a1: