Lineage for d2k0bx1 (2k0b X:1-52)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 907887Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 907911Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 907912Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 907964Protein Sequestosome 1 (Sqstm1) [101063] (1 species)
    ubiquitin-binding protein p62
  7. 907965Species Human (Homo sapiens) [TaxId:9606] [101064] (4 PDB entries)
  8. 907966Domain d2k0bx1: 2k0b X:1-52 [148253]
    automatically matched to d1q02a_

Details for d2k0bx1

PDB Entry: 2k0b (more details)

PDB Description: nmr structure of the uba domain of p62 (sqstm1)
PDB Compounds: (X:) Sequestosome-1

SCOPe Domain Sequences for d2k0bx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k0bx1 a.5.2.1 (X:1-52) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]}
gsppeadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh

SCOPe Domain Coordinates for d2k0bx1:

Click to download the PDB-style file with coordinates for d2k0bx1.
(The format of our PDB-style files is described here.)

Timeline for d2k0bx1: