Class a: All alpha proteins [46456] (284 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.2: UBA-like [46934] (4 families) |
Family a.5.2.1: UBA domain [46935] (24 proteins) |
Protein Sequestosome 1 (Sqstm1) [101063] (1 species) ubiquitin-binding protein p62 |
Species Human (Homo sapiens) [TaxId:9606] [101064] (4 PDB entries) |
Domain d2k0bx1: 2k0b X:1-52 [148253] automatically matched to d1q02a_ |
PDB Entry: 2k0b (more details)
SCOP Domain Sequences for d2k0bx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k0bx1 a.5.2.1 (X:1-52) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]} gsppeadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh
Timeline for d2k0bx1: