SCOPe 2.05: Domain d2jw8a_: 2jw8 A:

Lineage for d2jw8a_ (2jw8 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily)
   dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta

4. Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (2 families)

5. Family d.254.1.2: Coronavirus nucleocapsid protein [143508] (2 proteins)
   C-terminal part of Pfam PF00937

6. Protein automated matches [190565] (2 species)
   not a true protein

7. Species Human sars coronavirus [TaxId:227859] [255302] (1 PDB entry)

8. Domain d2jw8a_: 2jw8 A: [148226]
   automated match to d2cjra1

Details for d2jw8a_

PDB Entry: 2jw8

PDB Description: solution structure of stereo-array isotope labelled (sail) c-terminal dimerization domain of sars coronavirus nucleocapsid protein

PDB Compounds: (A:) nucleocapsid protein

SCOPe Domain Sequences for d2jw8a_:

Sequence; same for both SEQRES and ATOM records:

>d2jw8a_ d.254.1.2 (A:) automated matches {Human sars coronavirus [TaxId: 227859]}
tkksaaeaskkprqkrtatkqynvtqafgrrgpeqtqgnfgdqdlirqgtdykhwpqiaq
fapsasaffgmsrigmevtpsgtwltyhgaiklddkdpqfkdnvillnkhidayktfp

Timeline for d2jw8a_:

• d2jw8a_ first appeared in SCOP 1.75, called d2jw8a1
  
• d2jw8a_ appears in SCOPe 2.04
  
• d2jw8a_ appears in SCOPe 2.06
  
• d2jw8a_ appears in the current release, SCOPe 2.08