Lineage for d2jw8a_ (2jw8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008871Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily)
    dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta
  4. 3008872Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (3 families) (S)
  5. 3008883Family d.254.1.2: Coronavirus nucleocapsid protein [143508] (2 proteins)
    C-terminal part of Pfam PF00937
  6. 3008902Protein automated matches [190565] (3 species)
    not a true protein
  7. 3008903Species Human sars coronavirus [TaxId:227859] [255302] (1 PDB entry)
  8. 3008904Domain d2jw8a_: 2jw8 A: [148226]
    automated match to d2cjra1

Details for d2jw8a_

PDB Entry: 2jw8 (more details)

PDB Description: solution structure of stereo-array isotope labelled (sail) c-terminal dimerization domain of sars coronavirus nucleocapsid protein
PDB Compounds: (A:) nucleocapsid protein

SCOPe Domain Sequences for d2jw8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jw8a_ d.254.1.2 (A:) automated matches {Human sars coronavirus [TaxId: 227859]}
tkksaaeaskkprqkrtatkqynvtqafgrrgpeqtqgnfgdqdlirqgtdykhwpqiaq
fapsasaffgmsrigmevtpsgtwltyhgaiklddkdpqfkdnvillnkhidayktfp

SCOPe Domain Coordinates for d2jw8a_:

Click to download the PDB-style file with coordinates for d2jw8a_.
(The format of our PDB-style files is described here.)

Timeline for d2jw8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2jw8b_