![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (16 species) not a true protein |
![]() | Species Paramecium tetraurelia strain d4-2 [TaxId:412030] [161334] (1 PDB entry) |
![]() | Domain d2jvca1: 2jvc A:7-76 [148222] Other proteins in same PDB: d2jvca2 automatically matched to d1yiwa1 |
PDB Entry: 2jvc (more details)
SCOPe Domain Sequences for d2jvca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jvca1 d.15.1.1 (A:7-76) automated matches {Paramecium tetraurelia strain d4-2 [TaxId: 412030]} qifvktltgktitidvdhadtvgavkakiydkegippdqqrlifggkqledsnamsdynv qkestlhlvl
Timeline for d2jvca1: