Class a: All alpha proteins [46456] (289 folds) |
Fold a.284: YejL-like [158650] (1 superfamily) 6 helices; intertwined homodimer of three-helical subunits, bundle |
Superfamily a.284.1: YejL-like [158651] (1 family) |
Family a.284.1.1: YejL-like [158652] (5 proteins) Pfam PF07208; DUF1414 |
Protein Uncharacterized protein SO2176 [158661] (1 species) |
Species Shewanella oneidensis [TaxId:70863] [158662] (2 PDB entries) Uniprot Q8EF26 1-72 |
Domain d2juwb2: 2juw B:1-72 [148218] Other proteins in same PDB: d2juwa2, d2juwb3 automated match to d2jpqa1 |
PDB Entry: 2juw (more details)
SCOPe Domain Sequences for d2juwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2juwb2 a.284.1.1 (B:1-72) Uncharacterized protein SO2176 {Shewanella oneidensis [TaxId: 70863]} maiqskysntqvesliaeilvvlekhkaptdlslmalgncvthllerkvpsesrqavaeq fakalaqsvksn
Timeline for d2juwb2: