SCOPe 2.06: Domain d2juwb2: 2juw B:1-72

Lineage for d2juwb2 (2juw B:1-72)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.284: YejL-like [158650] (1 superfamily)
   6 helices; intertwined homodimer of three-helical subunits, bundle

4. Superfamily a.284.1: YejL-like [158651] (1 family)

5. Family a.284.1.1: YejL-like [158652] (5 proteins)
   Pfam PF07208; DUF1414

6. Protein Uncharacterized protein SO2176 [158661] (1 species)

7. Species Shewanella oneidensis [TaxId:70863] [158662] (2 PDB entries)
   Uniprot Q8EF26 1-72

8. Domain d2juwb2: 2juw B:1-72 [148218]
   Other proteins in same PDB: d2juwa2, d2juwb3
   automated match to d2jpqa1

Details for d2juwb2

PDB Entry: 2juw

PDB Description: nmr solution structure of homodimer protein so_2176 from shewanella oneidensis. northeast structural genomics consortium target sor77

PDB Compounds: (B:) UPF0352 protein SO_2176

SCOPe Domain Sequences for d2juwb2:

Sequence; same for both SEQRES and ATOM records:

>d2juwb2 a.284.1.1 (B:1-72) Uncharacterized protein SO2176 {Shewanella oneidensis [TaxId: 70863]}
maiqskysntqvesliaeilvvlekhkaptdlslmalgncvthllerkvpsesrqavaeq
fakalaqsvksn

Timeline for d2juwb2:

• d2juwb2 first appeared in SCOP 1.75, called d2juwb1
  
• d2juwb2 was called d2juwb_ in SCOPe 2.05
  
• d2juwb2 appears in SCOPe 2.07
  
• d2juwb2 appears in the current release, SCOPe 2.08