Lineage for d2jpqa1 (2jpq A:1-75)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2021029Fold a.284: YejL-like [158650] (1 superfamily)
    6 helices; intertwined homodimer of three-helical subunits, bundle
  4. 2021030Superfamily a.284.1: YejL-like [158651] (1 family) (S)
  5. 2021031Family a.284.1.1: YejL-like [158652] (5 proteins)
    Pfam PF07208; DUF1414
  6. 2021038Protein Hypothetical protein VP2129 [158657] (1 species)
  7. 2021039Species Vibrio parahaemolyticus [TaxId:670] [158658] (1 PDB entry)
    Uniprot Q87MV2 1-75
  8. 2021040Domain d2jpqa1: 2jpq A:1-75 [148167]
    Other proteins in same PDB: d2jpqa2, d2jpqb3

Details for d2jpqa1

PDB Entry: 2jpq (more details)

PDB Description: solution nmr structure of homodimer vp2129 from vibrio parahaemolyticus. northeast structural genomics consortium target vpr61.
PDB Compounds: (A:) UPF0352 protein VP2129

SCOPe Domain Sequences for d2jpqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jpqa1 a.284.1.1 (A:1-75) Hypothetical protein VP2129 {Vibrio parahaemolyticus [TaxId: 670]}
mpitskytdeqvekilaevalvlekhaaspeltlmiagniatnvlnqrvaasqrkliaek
faqalmssletpkth

SCOPe Domain Coordinates for d2jpqa1:

Click to download the PDB-style file with coordinates for d2jpqa1.
(The format of our PDB-style files is described here.)

Timeline for d2jpqa1:

2021040
d2jpqa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2jpqa2