![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin [54238] (9 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [89830] (14 PDB entries) |
![]() | Domain d2jt4b_: 2jt4 B: [148198] Other proteins in same PDB: d2jt4a_ automated match to d3cmmb_ protein/DNA complex |
PDB Entry: 2jt4 (more details)
SCOPe Domain Sequences for d2jt4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jt4b_ d.15.1.1 (B:) Ubiquitin {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d2jt4b_: