Lineage for d2jt4a_ (2jt4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783366Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187372] (12 PDB entries)
  8. 2783391Domain d2jt4a_: 2jt4 A: [238758]
    Other proteins in same PDB: d2jt4b_
    automated match to d1ruwa_
    protein/DNA complex

Details for d2jt4a_

PDB Entry: 2jt4 (more details)

PDB Description: solution structure of the sla1 sh3-3-ubiquitin complex
PDB Compounds: (A:) Cytoskeleton assembly control protein SLA1

SCOPe Domain Sequences for d2jt4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jt4a_ b.34.2.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
maskskkrgivqydfmaesqdeltiksgdkvyilddkkskdwwmcqlvdsgksglvpaqf
iepvrdkkhte

SCOPe Domain Coordinates for d2jt4a_:

Click to download the PDB-style file with coordinates for d2jt4a_.
(The format of our PDB-style files is described here.)

Timeline for d2jt4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2jt4b_