SCOPe 2.02: Domain d2jqia1: 2jqi A:14-164

Lineage for d2jqia1 (2jqi A:14-164)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.2: FHA domain [49885] (12 proteins)

6. Protein Phosphotyrosine binding domain of Rad53 [49886] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49887] (18 PDB entries)

8. Domain d2jqia1: 2jqi A:14-164 [148178]
   automatically matched to d1g3ga_

Details for d2jqia1

PDB Entry: 2jqi

PDB Description: nmr structure of the rad53 fha1 domain in complex with a phosphothreonien peptide derived from rad53 scd1

PDB Compounds: (A:) Serine/threonine-protein kinase RAD53

SCOPe Domain Sequences for d2jqia1:

Sequence; same for both SEQRES and ATOM records:

>d2jqia1 b.26.1.2 (A:14-164) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atqrfliekfsqeqigenivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpa
cdyhlgnisrlsnkhfqillgedgnlllndistngtwlngqkveknsnqllsqgdeitvg
vgvesdilslvifindkfkqcleqnkvdrir

Timeline for d2jqia1:

• d2jqia1 first appeared in SCOP 1.75
  
• d2jqia1 appears in SCOPe 2.01
  
• d2jqia1 appears in SCOPe 2.03
  
• d2jqia1 appears in the current release, SCOPe 2.08, called d2jqia_