Lineage for d2jqia1 (2jqi A:14-164)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1306941Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 1306942Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 1306976Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 1307004Protein Phosphotyrosine binding domain of Rad53 [49886] (1 species)
  7. 1307005Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49887] (18 PDB entries)
  8. 1307011Domain d2jqia1: 2jqi A:14-164 [148178]
    automatically matched to d1g3ga_

Details for d2jqia1

PDB Entry: 2jqi (more details)

PDB Description: nmr structure of the rad53 fha1 domain in complex with a phosphothreonien peptide derived from rad53 scd1
PDB Compounds: (A:) Serine/threonine-protein kinase RAD53

SCOPe Domain Sequences for d2jqia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jqia1 b.26.1.2 (A:14-164) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atqrfliekfsqeqigenivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpa
cdyhlgnisrlsnkhfqillgedgnlllndistngtwlngqkveknsnqllsqgdeitvg
vgvesdilslvifindkfkqcleqnkvdrir

SCOPe Domain Coordinates for d2jqia1:

Click to download the PDB-style file with coordinates for d2jqia1.
(The format of our PDB-style files is described here.)

Timeline for d2jqia1: