SCOPe 2.08: Domain d2jqfr_: 2jqf R:

Lineage for d2jqfr_ (2jqf R:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.2: FMDV leader protease [54037] (2 proteins)
   automatically mapped to Pfam PF05408

6. Protein FMDV leader protease [54038] (1 species)

7. Species Foot-and-mouth disease virus [TaxId:12110] [54039] (3 PDB entries)

8. Domain d2jqfr_: 2jqf R: [148174]
   automated match to d1qola_
   mutant

Details for d2jqfr_

PDB Entry: 2jqf

PDB Description: full length leader protease of foot and mouth disease virus c51a mutant

PDB Compounds: (R:) Genome polyprotein

SCOPe Domain Sequences for d2jqfr_:

Sequence, based on SEQRES records:

>d2jqfr_ d.3.1.2 (R:) FMDV leader protease {Foot-and-mouth disease virus [TaxId: 12110]}
meltlyngekktfysrpnnhdnawlnailqlfryveepffdwvysspenltleaikqled
ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh
avfacvtsngwyaiddedfypwtpdpsdvlvfvpydqeplngewkakvqrklk

Sequence, based on observed residues (ATOM records):

>d2jqfr_ d.3.1.2 (R:) FMDV leader protease {Foot-and-mouth disease virus [TaxId: 12110]}
meltlyngekktfysrpnnhdnawlnailqlfryveepffdwvysspenltleaikqled
ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh
avfacvtsngwyaiddedfypwtpdpsdvlvfvpydqkakvqrklk

Timeline for d2jqfr_:

• d2jqfr_ first appeared in SCOP 1.75, called d2jqfr1
  
• d2jqfr_ appears in SCOPe 2.07