Lineage for d1qola_ (1qol A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927054Family d.3.1.2: FMDV leader protease [54037] (2 proteins)
    automatically mapped to Pfam PF05408
  6. 2927055Protein FMDV leader protease [54038] (1 species)
  7. 2927056Species Foot-and-mouth disease virus [TaxId:12110] [54039] (3 PDB entries)
  8. 2927060Domain d1qola_: 1qol A: [37097]
    complexed with cl, edo

Details for d1qola_

PDB Entry: 1qol (more details), 3 Å

PDB Description: structure of the fmdv leader protease
PDB Compounds: (A:) protease (nonstructural protein p20a)

SCOPe Domain Sequences for d1qola_:

Sequence, based on SEQRES records: (download)

>d1qola_ d.3.1.2 (A:) FMDV leader protease {Foot-and-mouth disease virus [TaxId: 12110]}
meltlyngekktfysrpnnhdnawlnailqlfryveepffdwvysspenltleaikqled
ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh
avfacvtsngwyaiddedfypwtpdpsdvlvfvpydqeplngewkakvqrklk

Sequence, based on observed residues (ATOM records): (download)

>d1qola_ d.3.1.2 (A:) FMDV leader protease {Foot-and-mouth disease virus [TaxId: 12110]}
meltlyngekktfysrpnnhdnawlnailqlfryveepffdwvysspenltleaikqled
ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh
avfacvtsngwyaiddedfypwtpdpsdvlvfvpydqkakvqrklk

SCOPe Domain Coordinates for d1qola_:

Click to download the PDB-style file with coordinates for d1qola_.
(The format of our PDB-style files is described here.)

Timeline for d1qola_: