| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.2: FMDV leader protease [54037] (2 proteins) automatically mapped to Pfam PF05408 |
| Protein FMDV leader protease [54038] (1 species) |
| Species Foot-and-mouth disease virus [TaxId:12110] [54039] (3 PDB entries) |
| Domain d2jqfr_: 2jqf R: [148174] automated match to d1qola_ mutant |
PDB Entry: 2jqf (more details)
SCOPe Domain Sequences for d2jqfr_:
Sequence, based on SEQRES records: (download)
>d2jqfr_ d.3.1.2 (R:) FMDV leader protease {Foot-and-mouth disease virus [TaxId: 12110]}
meltlyngekktfysrpnnhdnawlnailqlfryveepffdwvysspenltleaikqled
ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh
avfacvtsngwyaiddedfypwtpdpsdvlvfvpydqeplngewkakvqrklk
>d2jqfr_ d.3.1.2 (R:) FMDV leader protease {Foot-and-mouth disease virus [TaxId: 12110]}
meltlyngekktfysrpnnhdnawlnailqlfryveepffdwvysspenltleaikqled
ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh
avfacvtsngwyaiddedfypwtpdpsdvlvfvpydqkakvqrklk
Timeline for d2jqfr_: