Lineage for d2jqfr_ (2jqf R:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534223Family d.3.1.2: FMDV leader protease [54037] (2 proteins)
    automatically mapped to Pfam PF05408
  6. 2534224Protein FMDV leader protease [54038] (1 species)
  7. 2534225Species Foot-and-mouth disease virus [TaxId:12110] [54039] (3 PDB entries)
  8. 2534237Domain d2jqfr_: 2jqf R: [148174]
    automated match to d1qola_
    mutant

Details for d2jqfr_

PDB Entry: 2jqf (more details)

PDB Description: full length leader protease of foot and mouth disease virus c51a mutant
PDB Compounds: (R:) Genome polyprotein

SCOPe Domain Sequences for d2jqfr_:

Sequence, based on SEQRES records: (download)

>d2jqfr_ d.3.1.2 (R:) FMDV leader protease {Foot-and-mouth disease virus [TaxId: 12110]}
meltlyngekktfysrpnnhdnawlnailqlfryveepffdwvysspenltleaikqled
ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh
avfacvtsngwyaiddedfypwtpdpsdvlvfvpydqeplngewkakvqrklk

Sequence, based on observed residues (ATOM records): (download)

>d2jqfr_ d.3.1.2 (R:) FMDV leader protease {Foot-and-mouth disease virus [TaxId: 12110]}
meltlyngekktfysrpnnhdnawlnailqlfryveepffdwvysspenltleaikqled
ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh
avfacvtsngwyaiddedfypwtpdpsdvlvfvpydqkakvqrklk

SCOPe Domain Coordinates for d2jqfr_:

Click to download the PDB-style file with coordinates for d2jqfr_.
(The format of our PDB-style files is described here.)

Timeline for d2jqfr_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2jqfs_